SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013112634.1.81496 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013112634.1.81496
Domain Number 1 Region: 3-83
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000824
Family Anti-sigma factor antagonist SpoIIaa 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013112634.1.81496
Sequence length 87
Comment hypothetical protein [Brachyspira murdochii]; AA=GCF_000092845.1; RF=representative genome; TAX=526224; STAX=84378; NAME=Brachyspira murdochii DSM 12563; strain=DSM 12563; AL=Complete Genome; RT=Major
Sequence
MAVIEISDNLNIRTMSKYFKNVIKSANYNEDITVKFNCEGPAHVDLAGLQILYAMKKELA
KNQKNLIVEGMDNLFVEYLNIINDKNN
Download sequence
Identical sequences D5U4F8
gi|296125150|ref|YP_003632402.1| WP_013112634.1.81496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]