SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013114732.1.81496 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013114732.1.81496
Domain Number 1 Region: 209-504
Classification Level Classification E-value
Superfamily TPR-like 9.2e-60
Family Tetratricopeptide repeat (TPR) 0.00098
Further Details:      
 
Domain Number 2 Region: 448-610
Classification Level Classification E-value
Superfamily Protein prenylyltransferase 2.43e-43
Family Protein prenylyltransferase 0.014
Further Details:      
 
Domain Number 3 Region: 128-250
Classification Level Classification E-value
Superfamily TPR-like 3.41e-28
Family Tetratricopeptide repeat (TPR) 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013114732.1.81496
Sequence length 617
Comment hypothetical protein [Brachyspira murdochii]; AA=GCF_000092845.1; RF=representative genome; TAX=526224; STAX=84378; NAME=Brachyspira murdochii DSM 12563; strain=DSM 12563; AL=Complete Genome; RT=Major
Sequence
MTRISNYLFNKHIEKCKISLKGFEKSEVQDLKDDFKKEAEKILADANNFLNGIDALNYSD
FDTFNSKAETFNDELNTILETFYIKDPDEIYTYNRFIEYFHYDNTMFNDENDKIDVNDLH
ILDEYFDYNTNGVVDNNTGSYEKAIEYYNKAIDLIPNYALAYYNRGLARNNLGFFKKAIK
DYDKAIELSKNYKDAYYNRGLAKNNANLHKEAIEDYSKVIELDHKNIDAYNNRGVSKNYL
HLFDEAIKDFNKILELDPNNYYAYGNRGNSKHDLGLYKEAIKDYDKAIKINPNYADCYYN
RANSKKELGLFKEAIKDYDNAIKWKPKDINVYINRGNAKYDLELYEEAIKDYDKIIKLDS
NYTDAYYNRANAKRELGLYNEAIKDYDKAIYLNPNYSEAYNNRGLAKSGLGMYKEAIKDY
EESIDLCADNPEAYYNIGSAKYDLGLLKESIKYYDKAIELRPTYSEAYNNRGLSKNDLEL
YKEAIKDYDKSIELNPNDSNTYNNRGLTKSSLGLYKEAIKDYSKAIELSPNYVYAYSNRG
SAKDELGEYKEAIKDYDKAIELKPNMAYLYNDRGWVKKNAGLYKEALKDYKKALELEPNN
EYAIENMKSLKKEYGLK
Download sequence
Identical sequences D5U4Y9
gi|296127340|ref|YP_003634592.1| WP_013114732.1.81496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]