SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013128940.1.1770 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013128940.1.1770
Domain Number 1 Region: 36-313
Classification Level Classification E-value
Superfamily SIS domain 5.68e-34
Family double-SIS domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013128940.1.1770
Sequence length 328
Comment mannose-6-phosphate isomerase [Thermosphaera aggregans]; AA=GCF_000092185.1; RF=na; TAX=633148; STAX=54254; NAME=Thermosphaera aggregans DSM 11486; strain=DSM 11486; AL=Complete Genome; RT=Major
Sequence
MEEMYLEWSRQARIALEKPVSVRFNRGFRSIIVAGMGGSGIVGDVLSTLSAKYSSLPVIT
VKNHILPGYTSPEDLLLVVSYSGNTIETLRIFDSALERNIPMVTVSSGGLLKTRAYEHGI
PHVKLPEGLAPRASLPSMLYGILKLLYENNLLNIPFKIIEDSVVFLEEKAGKAVADAGVI
AEWVNRCKGLLVISTHSPLESLGLRGKNEFNENAKIPVKVDVAPEWMHNDIVGYEEPFLK
DFTVLEVVDPDDKVGVMLVDFMRTIYAKVTGRFHRLVLEGVSLLDKIMYGSMVFGLSSCK
LARMRGIDPLKTASILEYKKVAGTIFSS
Download sequence
Identical sequences D5TZP7
WP_013128940.1.1770 gi|296241812|ref|YP_003649299.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]