SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013130731.1.18579 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013130731.1.18579
Domain Number 1 Region: 4-112
Classification Level Classification E-value
Superfamily DsrEFH-like 1.04e-19
Family DsrEF-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013130731.1.18579
Sequence length 120
Comment hypothetical protein [Thermobispora bispora]; AA=GCF_000092645.1; RF=representative genome; TAX=469371; STAX=2006; NAME=Thermobispora bispora DSM 43833; strain=DSM 43833; AL=Complete Genome; RT=Major
Sequence
MARSLVIKVTAGMDAPERCNQAFTVAAAAVASGVPVSLWLTGESAWFALPGRAKEFRLPE
ATPLEDLLDAVLTGGKVTLCTQCAARRGITVDDVIEGIRIAGAPTFVEEVLAEGAQALVY
Download sequence
Identical sequences D6Y4E4
WP_013130731.1.18579 gi|296268459|ref|YP_003651091.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]