SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013133486.1.18579 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013133486.1.18579
Domain Number 1 Region: 81-139
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000811
Family NfeD domain-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013133486.1.18579
Sequence length 143
Comment NfeD family protein [Thermobispora bispora]; AA=GCF_000092645.1; RF=representative genome; TAX=469371; STAX=2006; NAME=Thermobispora bispora DSM 43833; strain=DSM 43833; AL=Complete Genome; RT=Major
Sequence
MDLWLVWLIIAALLGIAEIFTLTAALGILGAAALLTAGIALLGLPLGAQLLVFAAASTAG
IVVVRPIARRLLRQPAPQRFGVSALIGKPAYVIKEVTAHDGRVRIGGEEWSARAYDESLV
IPAGTTVDVIQIEGATALVYPRE
Download sequence
Identical sequences D6Y8Z1
gi|296271214|ref|YP_003653846.1| WP_013133486.1.18579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]