SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013134070.1.41079 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013134070.1.41079
Domain Number 1 Region: 1-378
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 2.35e-99
Family Homocysteine S-methyltransferase 0.0000118
Further Details:      
 
Domain Number 2 Region: 336-599
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 7.59e-75
Family Methyltetrahydrofolate-utiluzing methyltransferases 0.00023
Further Details:      
 
Domain Number 3 Region: 866-1157
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 4.58e-66
Family Methionine synthase SAM-binding domain 0.0036
Further Details:      
 
Domain Number 4 Region: 713-845
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 2.49e-36
Family Cobalamin (vitamin B12)-binding domain 0.00016
Further Details:      
 
Domain Number 5 Region: 625-709
Classification Level Classification E-value
Superfamily Methionine synthase domain 1.44e-19
Family Methionine synthase domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013134070.1.41079
Sequence length 1157
Comment methionine synthase [Arcobacter nitrofigilis]; AA=GCF_000092245.1; RF=representative genome; TAX=572480; STAX=28199; NAME=Arcobacter nitrofigilis DSM 7299; strain=DSM 7299; AL=Complete Genome; RT=Major
Sequence
MKNRINEIIQNKVLIIDGAMGTQLQNAEIKPEAWKYENQDLEGCNELLNETAPEILEGIH
DAYAKAGANLISTNTFGTMPWVLDEYGISSKAYELSKLGAELVKKSCKKYETEDEPRFCL
GSIGPGTKLPSLGHIRYDEMYEGYKEVANGLADGGCDIYLLETCQDPLQIKAALHALTDT
HPEIPVMVSVTIELSGTMLIGTDAMTIAAIMSPFNILSLGFNCGTGPKQVHKHVKTLSEV
CKFPISVHANAGLPQNKGGVSYYPMGPEEFTQLQSSFLEINGVSFLGGCCGTTPEHIEAL
ANKVRGIKPKAPSGFLKASLASLFNTVPLKQDPAPLLIGERSNATGSKAFRDLLKDNNYE
GTLSVGQQQVRAGAHIIDVSVGFAGRDETGDMDKVVELYSQKVSLPLMPDSTQIKALEAA
LKQIGGRCIINSVNLEDGEEKFDAVCKLAKKFGAALVCLVIDEVGMAKTKEDKIRIAERI
YDLCVNRHGFNPEDLVFDMLTFTIGSGDDEYRTAGVETMEAIREFQILHPEVGTTLGLSN
ISFGLDIKARVYLNSIYLDHCVKAGLTSAIVNVKHILPLNKITEEDRKACDDLIFNNQED
GDPLFKFIDHFSNVEAQEDQSDEEYLKMEPIDKVKKLLLDGDKDRLLPLVDELRHTIKAE
MIVNEWLIDGMKIIGELFGSGQMQLPFVLQSAETMKATVDALNPYLPKEEKASETVLVIG
TVKGDVHDVGKNLVDIILSNNGFKVINIGIKADINDFIIAVQKHKAQAIGMSGLLVKSTA
VMKENLEELKRQGIDIPVLLGGAALTKSFVNEYCRPLYEGPIFYCRDAFDGVVSMQRIES
GDSFNTKLAADLIKDADDIKKEKKEVIIPPYEEIELPPKAEFTFPPLWGRVTQNKTLLNK
DLIFSWINHRVLFRQRWGYKKGAMKADEFLAHEEDVVKPLYEKYKEEFFEKDIFDPIAIY
GYYPCISHDNKLYIFDNEYAFNSLKEAQNVPPLEKAIKVFEFPRQTKAPYRCIADFFAND
RLDVVAFTLASSGLKITSYESELYQNSEFSKYHQIHGLGVELAEALAEVIHKQIRLDLDI
VPKEGHTLYDVQMKQYVGCRYSPGYAACPDLEQSRDIFDLLKPEEFGITLSETFQIDPEQ
STCAIVVPHNKANYYNI
Download sequence
Identical sequences D5V4W3
gi|296271800|ref|YP_003654431.1| WP_013134070.1.41079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]