SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013142390.1.49614 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013142390.1.49614
Domain Number 1 Region: 9-273
Classification Level Classification E-value
Superfamily Purine and uridine phosphorylases 2.23e-97
Family Purine and uridine phosphorylases 0.0000000018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013142390.1.49614
Sequence length 274
Comment S-methyl-5'-thioadenosine phosphorylase [Staphylothermus hellenicus]; AA=GCF_000092465.1; RF=na; TAX=591019; STAX=84599; NAME=Staphylothermus hellenicus DSM 12710; strain=DSM 12710; AL=Complete Genome; RT=Major
Sequence
MVLVKPPVKAEIGVIGGSGLYEIPDLQNIREYKIYTPYGMPSDNIIVGELRGRTIAFLPR
HGRGHKIPPHRINYRANIWALKSIGVKWIIAFSAVGSLREDYEPGDFVVPDQFIDMTKGI
RPTTFFEGGVVAHVSMADPFCEHLREIIIDAAKEIDGLMLHNKGTYICIEGPRFSTRAES
RIWKEVFKADIIGMTLVPEVNLACEAQTCYATVAMITDYDVWAEKPVTAEEVVRVMNENT
VKAKKLLPKIIERIPEKPLEDKCSCCKSLETALV
Download sequence
Identical sequences D7DAJ5
gi|297526067|ref|YP_003668091.1| WP_013142390.1.49614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]