SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013142778.1.49614 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013142778.1.49614
Domain Number 1 Region: 5-136
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 1.8e-26
Family CO dehydrogenase flavoprotein N-terminal domain-like 0.0038
Further Details:      
 
Domain Number 2 Region: 145-253
Classification Level Classification E-value
Superfamily CO dehydrogenase flavoprotein C-terminal domain-like 0.0000000000000144
Family CO dehydrogenase flavoprotein C-terminal domain-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013142778.1.49614
Sequence length 256
Comment molybdopterin dehydrogenase [Staphylothermus hellenicus]; AA=GCF_000092465.1; RF=na; TAX=591019; STAX=84599; NAME=Staphylothermus hellenicus DSM 12710; strain=DSM 12710; AL=Complete Genome; RT=Major
Sequence
MIRDRRIPIPKHLVDLNAIKRELSFVEKKDDGIHIGGGTTLYELSQTFLHKDKRFAGFVD
VYKKFGTLALRFEATIAGNLVSATQYNDYITLLLVYDAKLRLVSANGERIVRLEDFLIDK
RKVDLKPNELIYEIIFSEPPMNSSSSFIKFDRRELLIAGVVTGAAFLALEDNKIADVKIS
FDMVREKRIPGRARKSEEFLKGKEFSEEILEKVAEEVLPTEMERVTDWWTNAEYRMDMSK
VVLKRNLLRAYKRIKG
Download sequence
Identical sequences D7DBN3
gi|297526455|ref|YP_003668479.1| WP_013142778.1.49614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]