SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013143646.1.49614 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013143646.1.49614
Domain Number 1 Region: 16-138
Classification Level Classification E-value
Superfamily Single hybrid motif 4.12e-43
Family Biotinyl/lipoyl-carrier proteins and domains 0.0000168
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013143646.1.49614
Sequence length 143
Comment glycine cleavage system protein H [Staphylothermus hellenicus]; AA=GCF_000092465.1; RF=na; TAX=591019; STAX=84599; NAME=Staphylothermus hellenicus DSM 12710; strain=DSM 12710; AL=Complete Genome; RT=Major
Sequence
MTDEIVVEVGKKKYIIKTDRKYTETDEWAKIENEIVVIGITDYAQKELKDIVGVELPETG
KNIKKGEELGVIESVKATSEYYAPVSGEIMEVNERLLEEPELLNIDPYGEGWIAKIKPQD
PREYESLLPPEKYAEIIKQKETK
Download sequence
Identical sequences D7D9K2
WP_013143646.1.49614 gi|297527323|ref|YP_003669347.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]