SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013151811.1.70090 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013151811.1.70090
Domain Number 1 Region: 353-535
Classification Level Classification E-value
Superfamily vWA-like 6.85e-16
Family Integrin A (or I) domain 0.011
Further Details:      
 
Domain Number 2 Region: 43-330
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.0000000000000048
Family Phosphate binding protein-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013151811.1.70090
Sequence length 547
Comment VWA domain-containing protein [Nocardiopsis dassonvillei]; AA=GCF_000092985.1; RF=representative genome; TAX=446468; STAX=2014; NAME=Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111; strain=DSM 43111; AL=Complete Genome; RT=Major
Sequence
MAAGTGTGRIRGGRGVRGACAAVLAAALAATGCSAPGADPDVTLRILAGSEVADLEPLLE
EAGERTGVTVELEYTGTLDGMARIAAGDRQGEGGEYDAVWFASNRYLNLDGDGRSAVHEE
TPVMVSPVVLGVAADRARELGWDGGAEVTWSDVHRAVVEEELIYGMTNPGASNSGFSALI
GVASALADTGAALRSEDVERVGPELAEFFAGQEVTAGSSGWLTDAFVRRAESGMPVDGLV
NYESVILSLNASGALEEPLTVVYPADGVVTADYPLTLLSDPSEQALDGYERLVGDLTSEE
TQQQIADRTWRRPVTAGAELSPPVPPLVELPFPASREVVDGLVADYSASLRRPARTVYAL
DVSGSMEGGRLAELQSALGALTGADGGSLARSTQAFQEREVVTLLPFSTWPADPRTFVVE
PGSVDEVNADLSAAVEGLEAEGDTAAYDALVRAYELLESDTGSDGDPLMSVVLMTDGEVN
RGVGLEGFRESLAARSEPVARVPVFTVLFGESDVPEMTELAELTGGRVFDAREQDLEQVF
REIRGYQ
Download sequence
Identical sequences D7AYL9
gi|297559736|ref|YP_003678710.1| WP_013151811.1.70090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]