SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013153622.1.70090 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013153622.1.70090
Domain Number 1 Region: 39-404
Classification Level Classification E-value
Superfamily Cytochrome P450 2.75e-54
Family Cytochrome P450 0.0000299
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013153622.1.70090
Sequence length 500
Comment cytochrome P450 [Nocardiopsis dassonvillei]; AA=GCF_000092985.1; RF=representative genome; TAX=446468; STAX=2014; NAME=Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111; strain=DSM 43111; AL=Complete Genome; RT=Major
Sequence
MRQGTGTDGRDDPPSAGSGGARCPVALPPRGDTGADTPWDALRDRHGGLVPVEVGPGVPG
WLLLGYRENLQALRDHTLFSADPRPWGAEDAAPARSAALARDGEEHRRLRAAVVDTLARA
DTPRLVPVVERAAVHLLGRVAADGAADLIGGFAAPLPALVLNELFGLPDAYGRLLADLAP
RLWSGEPDRAGPAATAVRSYFAGLVARKRADPGQDMASWLLAHPAGLTDDEAAGALALLW
ESGHEPTTHLIGNALLRLLEDPGVWTAYLGGTLTPEDFIDYVMWTDSPIRVLGGRYPVED
LSFSGARVRRGEPLLLGLASAHTDPSVARGDDAMARAGDRSHLSWGAGAHRCPATGLTRE
LARTAIDTAVDRLRGMVLAVEPEELRWRASLAVHGLEELPVWFTATGERAGSDAPVRERA
PAPVTRRLRRKRGPAPRGARYQAPLAGEDGERAREERPAPAPRSRRVARGAGARYQAPFA
TERADPDALERLLAAWRSRD
Download sequence
Identical sequences D7AXW1
gi|297561547|ref|YP_003680521.1| WP_013153622.1.70090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]