SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013154057.1.70090 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013154057.1.70090
Domain Number 1 Region: 2-332
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.97e-97
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.00000000702
Further Details:      
 
Domain Number 2 Region: 336-428
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 1.31e-17
Family Tyrosyl-tRNA synthetase (TyrRS), C-terminal domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013154057.1.70090
Sequence length 432
Comment tyrosine--tRNA ligase [Nocardiopsis dassonvillei]; AA=GCF_000092985.1; RF=representative genome; TAX=446468; STAX=2014; NAME=Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111; strain=DSM 43111; AL=Complete Genome; RT=Major
Sequence
MTDIIDELQWRGLLAQTTDLDALRKALADGPITLYCGFDPTAGSLHVGHLTQILTLARFQ
QAGHRPIALVGGGTGLIGDPKPNAERQLNSLETVRGWVDNLGGQLSAFLRFTPEGEQPEP
TDAVLANNADWLGEINAIELLRDVGKHFSVNQMLARETVRSRLDGEGMSYTEFSYVLLQS
YDYVQLYRRFGCTLQTGGSDQWGNITAGLDLVRRMDGNEPHGQAHGLTTNLLTKADGTKF
GKTESGSVWLDPELTSPYAFYQFWFNADDRDVVRYLKTFSFRDRDEIEELERQTEERPQA
RAAQRVLAEDLTVLVHGEEECRKVKEASLALFGRADLSDLDARTLEAALAEVPRAEVDGP
VDGLLVTDAFARSGLTPSKSAARRAIQEGGAYVNNVKVTDVEAVLRPEDVLQGRFVVLRK
GKRNIGGLVLNG
Download sequence
Identical sequences D7B1M4
gi|297561982|ref|YP_003680956.1| WP_013154057.1.70090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]