SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013182550.1.67671 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013182550.1.67671
Domain Number 1 Region: 9-81
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.28e-29
Family Cold shock DNA-binding domain-like 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013182550.1.67671
Sequence length 83
Comment 30S ribosomal protein S17 [Waddlia chondrophila]; AA=GCF_001618265.1; RF=na; TAX=716544; STAX=71667; NAME=Waddlia chondrophila WSU 86-1044; strain=WSU 86-1044; AL=Contig; RT=Major
Sequence
MTAKGTAKRKTKTGTVVSNKMDKTVIVRVERTMQHPRYGKVIKRANKFYAHVENDQLQIG
DTVTISETRPYSKLKRWRVVEKN
Download sequence
Identical sequences D6YRZ7 F8LA76
gi|297621711|ref|YP_003709848.1| WP_013182550.1.19835 WP_013182550.1.67671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]