SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013192583.1.25658 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013192583.1.25658
Domain Number 1 Region: 4-251
Classification Level Classification E-value
Superfamily PHP domain-like 3.73e-35
Family PHP domain 0.0099
Further Details:      
 
Domain Number 2 Region: 775-865
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 8.83e-17
Family Intein (protein splicing domain) 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013192583.1.25658
Sequence length 877
Comment trans-splicing intein-formed DNA polymerase III subunit alpha N-terminal partner DnaE-N [Trichormus azollae]; AA=GCF_000196515.1; RF=representative genome; TAX=551115; STAX=1164; NAME='Nostoc azollae' 0708; strain=0708; AL=Complete Genome; RT=Major
Sequence
MSFVPLHIHSDYSLLDGASQLPELVDQAITLGMKAIALTDHGVMYGAVELIKVCRSKNIK
PIIGNEMYIINGDIEKQERRPKYHQVVLAKNTKGYRNLVKLTTISHLQGVQGKGIFSRPC
INKNSLKEYKEGLIVTSACLGGEIPQAILSKRPDAARKVAKWYKEVFGEDFYLEIQDHGS
QEDRIVNVEIVKIARELGIKFIATNDSHYISCFDVEAHDALLCIQTGQLISEDKRMRYSG
TEYLKSAQEMQQLFRDHLPDYVIAEAIATTEEVGDKIEPYHIMDEPKIPTPPIPSGHTPD
TYAEEIAWQGLLERLNRKSRSEVDQIYKERLEYELKMLQRMGFSTYFLVVWDYIKFARDN
NIPVGPGRGSAAGSLVAYAMRITNIDPVHHGLLFERFLNPERKSMPDIDTDFCIEKRDQV
IEYVTNKYGADRVAQIITFNRLTSKAVLKDVARVLDIPYGEADKMAKMIPVVRGKPTKLK
VMVSNETPAPEFKEKYDHDAKIRHWLDMAMRIEGTNKTFGVHAAGVVISAEPLDEIVPLQ
RNNDGSVITQYFMEDLESLGLLKMDFLGLRNLTLIQKTIDLIQETNGYKIDPDEITGQER
KAQHILAKGQHSTLPKEVQKAYSLLESGDLEGVFQLESSGMKQIVRDLKPSNIEDISSIL
ALYRPGPLDAGLIPKFINRKHRREEIEYETGILEPILNETYGIMVYQEQIMKIAQDMAGY
SLGQADLLRRAMGKKKVSEMQKQEEKFIDGAMKNGVKKQVAEKLFADMLKFAEYCLSYKT
EVLTVEYGLIPIGEIVEKRIECSLFSVDENGNIYTQPIAQWHHRGVQEVYEYCLDDGTII
RATKDHKFMTTIGEMLPIDEIFERDLNLLQVNGLPTE
Download sequence
Identical sequences D7DW01
WP_013192583.1.25658 gi|298492518|ref|YP_003722695.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]