SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013194998.1.99978 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013194998.1.99978
Domain Number 1 Region: 12-462
Classification Level Classification E-value
Superfamily L-aspartase-like 1.88e-118
Family L-aspartase/fumarase 0.000000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013194998.1.99978
Sequence length 492
Comment argininosuccinate lyase [Methanohalobium evestigatum]; AA=GCF_000196655.1; RF=representative genome; TAX=644295; STAX=2322; NAME=Methanohalobium evestigatum Z-7303; strain=Z-7303; AL=Complete Genome; RT=Major
Sequence
MSDILRRGRLSEIPDDEVLKYISSMETDRWIFQADILVDMAHTIMLEEQEIIHEEECTRI
LEALLKIKEDGIESLSHDYEDIHISLESKLIDMVGEDIGGKMHSGRSRNDEIATCLRIYL
RDEITGIMSELVNLRTVLLKIASYNVDTVMPGFTHLQHAQPTTFAHHLVAHAESLSRDFD
RLFDAFKRINMCPLGSAAFASTGFNLNRTRTQELLGFDGLIENSMDAVSTRDFLVESASV
LSNLMINLSRMAEEIIIWSSPEFNFVELGDKYASTSSIMPQKKNPDTAELIRGKTGSSIG
SLTSLLSICKALPMSYNRDLQEANPSIVNTVNITSSSVKIMSGMFEDMNINSEVMLSRSK
EGFTTATELADTLVRVTGIPFRTAHQIIGAIAKEPGTPTIEKIDNVSLDVLGKKLSDIGL
TEGLVQEALDPVLNIKKRDVIGGPAPDEMLRCINNCKSKLENDEKKLEKVNSNIGSSIDN
LFELVDGCIKSK
Download sequence
Identical sequences D7EAR6
WP_013194998.1.99978 gi|298675479|ref|YP_003727229.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]