SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013215006.1.30340 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013215006.1.30340
Domain Number 1 Region: 20-449
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.94e-122
Family GABA-aminotransferase-like 0.0000081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013215006.1.30340
Sequence length 461
Comment aspartate aminotransferase family protein [Hyphomicrobium denitrificans]; AA=GCF_000143145.1; RF=representative genome; TAX=582899; STAX=53399; NAME=Hyphomicrobium denitrificans ATCC 51888; strain=ATCC 51888; AL=Complete Genome; RT=Major
Sequence
MSNRLQTAQIQELDSQHHLHPFTTHQTLRAGPGPRVIVKGEGAYVIDSEGNRILDGMAGL
WTTNIGYGNKELAQAAYDQILELPFYNTFFKTTHPPVVELSRKLAELAPAHLNQVFFGSS
GSESNDTAIRLIRHYWVLKGQPKRRIIISRKNAYHGSTIAAGSMGGMTHVHQHSYPVYEG
FRHVMDPYWYGDSFAGESPEDFGLRAARAIEEEILRCGPDNVAAFAGEPVQGAGGVKIAP
DSYWPEVQRIVDKYGILLLADEVITGFGRLGTWFGSEYYGIRPDLITFAKAATSGYVPLS
GVLVGDNIVDALMAENDDFNHGYTFSGHPVACAVALKNLEIMERDRLVPRVKETTGPALA
RMLERFKDHPLVGEVRSIGMMGAIELVADKKTRRRFTDPGRVGLICRDHFFRDGFIMRAV
FDTMVCAPPLIWTDAEFEKAGAVIESALNKTLQDVKGELTA
Download sequence
Identical sequences D8JUX5
WP_013215006.1.30340 gi|300022501|ref|YP_003755112.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]