SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013223646.1.26188 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013223646.1.26188
Domain Number 1 Region: 4-196
Classification Level Classification E-value
Superfamily DhaL-like 7.98e-32
Family DhaL-like 0.0054
Further Details:      
 
Weak hits

Sequence:  WP_013223646.1.26188
Domain Number - Region: 313-396
Classification Level Classification E-value
Superfamily Tetrapyrrole methylase 0.0733
Family Tetrapyrrole methylase 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013223646.1.26188
Sequence length 524
Comment dihydroxyacetone kinase [Amycolatopsis mediterranei]; AA=GCF_001742805.1; RF=na; TAX=33910; STAX=33910; NAME=Amycolatopsis mediterranei; strain=HP-130; AL=Scaffold; RT=Major
Sequence
MRVLDAAAVSAWAAGCVHSLASLRPAIDEINVYPVADSDTGSNMLFTMTGAARELSEATP
GDAAEALKVLARGAVASAKGNSGVILSQVVRGLADRAEGDLDGPWLARALGHADEVATGA
VSRPVAGTILTVLHAVALAVRGDTSSLGDIAAKAAKEAAHALEKTPEQLPALARAGVVDA
GARGLVAVLDALVGVLTGTPLEQEHALEVRTELPDAYAWEVMYLLDGVDEASLPTLRKEL
SGLGDSVTVAGDGSGSHAVHVHCADIGAAIEAGLALGRPRRIRVEPLLTPTPIEPGGGID
RTVVAVVHGGALAELLRAESIPVLAVPEGGTPSVEDMIGLFNEAAGRQVTVLPGSVALTA
AADTAAGHAMAADRDVVVIPCASPVQVLAALAVHDAGRRTNDDVVAMAEAAAATRRGELR
IAQEESLTWVGRAQSGDVVGLVDDEVVLIEPAPASETNLVAAAMKVLNRMLALGGELVTV
LSGAAAPPGVAEELAEQLRVEHPEVEMAGYASGQADAVLLMGVE
Download sequence
Identical sequences A0A0H3CYX5 G0FPG6
gi|532458420|ref|YP_008458072.1| gi|300783674|ref|YP_003763965.1| gi|399535558|ref|YP_006548220.1| gi|399535558|ref|YP_006548220.1| WP_013223646.1.26188 WP_013223646.1.53613 WP_013223646.1.63706 WP_013223646.1.79787 WP_013223646.1.88400 WP_013223646.1.99940 YP_003763965.1.66228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]