SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013234009.1.93079 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013234009.1.93079
Domain Number 1 Region: 163-351
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 6.02e-71
Family Methylesterase CheB, C-terminal domain 0.000000322
Further Details:      
 
Domain Number 2 Region: 1-107
Classification Level Classification E-value
Superfamily CheY-like 9.68e-29
Family CheY-related 0.00000792
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013234009.1.93079
Sequence length 359
Comment chemotaxis response regulator protein-glutamate methylesterase [Herbaspirillum seropedicae]; AA=GCF_000143225.1; RF=na; TAX=757424; STAX=964; NAME=Herbaspirillum seropedicae SmR1; strain=SmR1; AL=Complete Genome; RT=Major
Sequence
MKIKVLIVDDSALIRSVMREIIGSQPDMEVVGVAPDPIIARELIKQTNPDVLTLDVEMPR
MDGLDFLEKLMRLRPMPVVMVSSLTERGSEITLRALELGAIDFVTKPKISIQSGMQEYAD
MIADKIRAAAKARVRARPARSAEQAAGGGSEALPQIRNPLTSSEKLIIIGASTGGTEAIK
EFLIRMPSDCPGILITQHMPEGFTRSFAQRLNNLCKISVVESAGNERVLPGHAYIAPGHS
HLKLVRSGANYMTQLDQGPPVNRHRPSVDVLFQSAATCAGKNAVGVILTGMGKDGAQGML
EMRNAGAYNFAQDEASCVVFGMPREAIAVGAAHEVLALQAMPGRVLAWLAEHGSRALRV
Download sequence
Identical sequences D8ISH8
WP_013234009.1.82484 WP_013234009.1.93079 gi|300311338|ref|YP_003775430.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]