SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013235323.1.93079 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013235323.1.93079
Domain Number 1 Region: 13-199
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.57e-56
Family Methylesterase CheB, C-terminal domain 0.0000713
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013235323.1.93079
Sequence length 211
Comment chemotaxis protein CheB [Herbaspirillum seropedicae]; AA=GCF_000143225.1; RF=na; TAX=757424; STAX=964; NAME=Herbaspirillum seropedicae SmR1; strain=SmR1; AL=Complete Genome; RT=Major
Sequence
MSELPLPELAARPIEAIVIGASAGGVEALSEILPALRRGAAVATMVVLHLPRERPSLLAQ
IFADRCRQPVVEAQDKEPAQAGVIHFAPPDYHLLVDRSEDGPILAMSNDELVNYSRPAID
VLFESAADVYGPRLLGILLTGGNHDGAAGMQAIARAGGVTVVQSPQQAQVPYMPAQALAM
GNIDYVLTLQQIADLLRTLGASGLAQEKERR
Download sequence
Identical sequences D8J276
WP_013235323.1.21123 WP_013235323.1.82484 WP_013235323.1.93079 gi|300312675|ref|YP_003776767.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]