SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013241502.1.47148 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013241502.1.47148
Domain Number 1 Region: 18-194
Classification Level Classification E-value
Superfamily Formyltransferase 8.77e-49
Family Formyltransferase 0.000023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013241502.1.47148
Sequence length 208
Comment phosphoribosylglycinamide formyltransferase [Corynebacterium pseudotuberculosis]; AA=GCF_001663495.1; RF=na; TAX=1719; STAX=1719; NAME=Corynebacterium pseudotuberculosis; strain=PA02; AL=Complete Genome; RT=Major
Sequence
MTDEIHLKTDHESAALPIVVMASGSGTLLQAIIDHQGAYKVVGVVADVSCPAITRAETAG
IPAEVVSYASGDDREKWNKALAVAVEKHAPAIVVSAGFMRILGKTFLEKFPGRIINTHPA
LLPAFPGAHAVRDALAYGVKVTGSTVHFIDEGVDTGKIIAQVPVSIEPGESEAHLHERIK
HVERKLIVSVLNSATTEKKSEEVFFTYE
Download sequence
Identical sequences A0A1L3KW93 D9Q9A1
gi|387138246|ref|YP_005694225.1| WP_013241502.1.10990 WP_013241502.1.11204 WP_013241502.1.13534 WP_013241502.1.15940 WP_013241502.1.16076 WP_013241502.1.18294 WP_013241502.1.23262 WP_013241502.1.24212 WP_013241502.1.24230 WP_013241502.1.25418 WP_013241502.1.26120 WP_013241502.1.27593 WP_013241502.1.28798 WP_013241502.1.28877 WP_013241502.1.31683 WP_013241502.1.3373 WP_013241502.1.34597 WP_013241502.1.36079 WP_013241502.1.38385 WP_013241502.1.38411 WP_013241502.1.40652 WP_013241502.1.40681 WP_013241502.1.43256 WP_013241502.1.45686 WP_013241502.1.46769 WP_013241502.1.47148 WP_013241502.1.53184 WP_013241502.1.55662 WP_013241502.1.56904 WP_013241502.1.58055 WP_013241502.1.58647 WP_013241502.1.59640 WP_013241502.1.61967 WP_013241502.1.6216 WP_013241502.1.6597 WP_013241502.1.68185 WP_013241502.1.71708 WP_013241502.1.72847 WP_013241502.1.73584 WP_013241502.1.7404 WP_013241502.1.75733 WP_013241502.1.780 WP_013241502.1.78842 WP_013241502.1.79363 WP_013241502.1.80150 WP_013241502.1.8025 WP_013241502.1.81226 WP_013241502.1.81362 WP_013241502.1.85367 WP_013241502.1.88492 WP_013241502.1.91917 WP_013241502.1.92600 WP_013241502.1.94788 WP_013241502.1.95330 WP_013241502.1.96532 WP_013241502.1.9720 WP_013241502.1.97212 gi|392400194|ref|YP_006436794.1| gi|384510519|ref|YP_005690097.1| gi|300858063|ref|YP_003783046.1| gi|387136183|ref|YP_005692163.1| gi|387140258|ref|YP_005696236.1| gi|375288231|ref|YP_005122772.1| gi|386739984|ref|YP_006213164.1| gi|379714926|ref|YP_005303263.1| gi|384504246|ref|YP_005680916.1| gi|384506336|ref|YP_005683005.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]