SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013242886.1.81362 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013242886.1.81362
Domain Number 1 Region: 61-149
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 5.23e-24
Family Ribosomal protein L9 C-domain 0.00038
Further Details:      
 
Domain Number 2 Region: 1-57
Classification Level Classification E-value
Superfamily L9 N-domain-like 8.2e-17
Family Ribosomal protein L9 N-domain 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013242886.1.81362
Sequence length 150
Comment 50S ribosomal protein L9 [Corynebacterium pseudotuberculosis]; AA=GCF_000221625.1; RF=na; TAX=935298; STAX=1719; NAME=Corynebacterium pseudotuberculosis PAT10; strain=PAT10; AL=Complete Genome; RT=Major
Sequence
MKLILTAAVENLGVPGDIVEVKDGYGRNLLLPRGLAIVATRGAEKQIEGIKRAQEARAIR
DLDHAREVKAQLEALEGVTVAVKTSEKGKLFGSVSAEDIAAAVKKAGGPNLDKRSIELPK
RLVKSIGTFSVNVKLHSDIAATVNFEVVAA
Download sequence
Identical sequences A0A1L6D3S5 D9QD45
WP_013242886.1.10260 WP_013242886.1.10990 WP_013242886.1.11204 WP_013242886.1.13534 WP_013242886.1.1517 WP_013242886.1.15940 WP_013242886.1.16076 WP_013242886.1.16360 WP_013242886.1.17000 WP_013242886.1.18294 WP_013242886.1.23262 WP_013242886.1.24212 WP_013242886.1.24230 WP_013242886.1.25418 WP_013242886.1.26120 WP_013242886.1.27158 WP_013242886.1.27593 WP_013242886.1.27718 WP_013242886.1.27807 WP_013242886.1.28798 WP_013242886.1.28877 WP_013242886.1.31683 WP_013242886.1.3373 WP_013242886.1.34597 WP_013242886.1.36079 WP_013242886.1.38385 WP_013242886.1.38411 WP_013242886.1.40652 WP_013242886.1.43256 WP_013242886.1.45686 WP_013242886.1.46769 WP_013242886.1.47148 WP_013242886.1.4891 WP_013242886.1.53184 WP_013242886.1.55662 WP_013242886.1.56904 WP_013242886.1.58055 WP_013242886.1.58647 WP_013242886.1.59640 WP_013242886.1.61967 WP_013242886.1.6216 WP_013242886.1.6597 WP_013242886.1.68185 WP_013242886.1.70614 WP_013242886.1.71708 WP_013242886.1.72847 WP_013242886.1.73584 WP_013242886.1.7404 WP_013242886.1.75733 WP_013242886.1.780 WP_013242886.1.78842 WP_013242886.1.79363 WP_013242886.1.80150 WP_013242886.1.8025 WP_013242886.1.81226 WP_013242886.1.81362 WP_013242886.1.85367 WP_013242886.1.88492 WP_013242886.1.90433 WP_013242886.1.90599 WP_013242886.1.91917 WP_013242886.1.92600 WP_013242886.1.94788 WP_013242886.1.95330 WP_013242886.1.96532 WP_013242886.1.9720 WP_013242886.1.97212 gi|387141560|ref|YP_005697538.1| gi|384505615|ref|YP_005682285.1| gi|389851366|ref|YP_006353601.1| gi|384511882|ref|YP_005691460.1| gi|300859449|ref|YP_003784432.1| gi|387137531|ref|YP_005693511.1| gi|386741333|ref|YP_006214513.1| gi|383315196|ref|YP_005376051.1| gi|385808503|ref|YP_005844900.1| gi|384509801|ref|YP_005686469.1| gi|375289643|ref|YP_005124184.1| gi|387139594|ref|YP_005695573.1| gi|384507705|ref|YP_005684374.1| gi|379716308|ref|YP_005304645.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]