SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013243056.1.6222 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013243056.1.6222
Domain Number 1 Region: 1-119
Classification Level Classification E-value
Superfamily CheY-like 3.84e-31
Family CheY-related 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013243056.1.6222
Sequence length 120
Comment response regulator [Brachyspira pilosicoli]; AA=GCF_000143725.1; RF=na; TAX=759914; STAX=52584; NAME=Brachyspira pilosicoli 95/1000; strain=95/1000; AL=Complete Genome; RT=Major
Sequence
MPKKTILVLDDEKSIRTLFEEEFKDEGYNVVSTDSGEEALEMINKDNPHIDLITLDIKMP
KMDGLDFLGKVRENHRELPIIICTAYNNYRHEFQVWNADGYILKSGNLTEIKDKIKRLIG
Download sequence
Identical sequences D8I9Y4 J9UM72 K0JG32
gi|300869731|ref|YP_003784602.1| gi|431807200|ref|YP_007234098.1| gi|434382298|ref|YP_006704081.1| WP_013243056.1.48933 WP_013243056.1.6222 WP_013243056.1.67631 WP_013243056.1.92922 gi|404476037|ref|YP_006707468.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]