SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013244271.1.6222 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013244271.1.6222
Domain Number 1 Region: 183-370
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.31e-54
Family Methylesterase CheB, C-terminal domain 0.0000133
Further Details:      
 
Domain Number 2 Region: 5-122
Classification Level Classification E-value
Superfamily CheY-like 0.00000000000000135
Family CheY-related 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013244271.1.6222
Sequence length 378
Comment chemotaxis response regulator protein-glutamate methylesterase [Brachyspira pilosicoli]; AA=GCF_000143725.1; RF=na; TAX=759914; STAX=52584; NAME=Brachyspira pilosicoli 95/1000; strain=95/1000; AL=Complete Genome; RT=Major
Sequence
MGLFINILIAEDSKEISDNIKKILLKNPAVKIVNIVNNGIDAYKTIINKKIDFAFVEFNL
PMMSASELLKQLKKESINTKVIVLSTTDKNDDLNTRILNLGAFKIINKNAKIEYIENEIS
SIIINKNIKKEENIREIKIDESIKNNLFRNTTIQKNTINTFPHNISRVSDVIKKINYSDF
KNPKLIAIGISTGGPKALRSLIPSIPKNFPIPILIAQHIPKDFSSSLAKGLNDVSQITVK
EAEDNEEVKAGFAYICPGENNMGIYLDNDNIKIKLRPDLKLDLPYMPSVNHLFNTINDNL
KDQAIAVIMTGMGNDGTEGMINLYNNKNLTIAQNKTTSTIFGMPKSAIENNAVHFIISLY
DMAEFLVQYTTIKLKGLY
Download sequence
Identical sequences D8IDU7
WP_013244271.1.6222 gi|300870950|ref|YP_003785821.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]