SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013247171.1.3676 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_013247171.1.3676
Domain Number - Region: 16-106
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0129
Family Multidrug resistance efflux transporter EmrE 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013247171.1.3676
Sequence length 109
Comment hypothetical protein [Nitrospira defluvii]; AA=GCF_000196815.1; RF=representative genome; TAX=330214; STAX=330214; NAME=Nitrospira defluvii; AL=Complete Genome; RT=Major
Sequence
MHTILLLTVSNIFMTFAWYGHLKYKESPLWIAILASWGIAFVEYCFQVPANRIGHYEFTA
AQLKTIQEVITLIVFCVFSVLYLKEELKWNYLVGFGMMIGAVFFVFKEW
Download sequence
Identical sequences D8PAT6
gi|302035949|ref|YP_003796271.1| WP_013247171.1.3676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]