SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013247630.1.3676 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013247630.1.3676
Domain Number 1 Region: 191-297
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00000000000000615
Family Multidrug resistance efflux transporter EmrE 0.0093
Further Details:      
 
Domain Number 2 Region: 45-143
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.000000000183
Family Multidrug resistance efflux transporter EmrE 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013247630.1.3676
Sequence length 303
Comment EamA family transporter [Nitrospira defluvii]; AA=GCF_000196815.1; RF=representative genome; TAX=330214; STAX=330214; NAME=Nitrospira defluvii; AL=Complete Genome; RT=Major
Sequence
MQKPSVFAAYAALTTSALVWGGSIVGQKLALGVFSAVETSLLRGFGALVILIPLWWWREG
GRTTWTARDLKLLSLLGLGVLGNHLLTLFGLRYIGAATAGVIIGASPAITALLSSLLVRD
IPFKTVAAGCAVSFAGVALVSGVGGGAPSGDSPWLGGTLVLLGLVSWALYSIGGRQVMER
LSPLTVNWTTLLLSLLLQIPLLWTDQKLLLTGATAVPISGWVALVYLIVFATALGQQAWL
YGVQGVGPSRAGVFVNLIPVSALLLSALVLGEAIGIREIVGIALILAGVWLVGWQSARLT
RAG
Download sequence
Identical sequences D8PC45
WP_013247630.1.3676 gi|302036408|ref|YP_003796730.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]