SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013248426.1.3676 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013248426.1.3676
Domain Number 1 Region: 3-208
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.82e-69
Family Glutathione peroxidase-like 0.00000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013248426.1.3676
Sequence length 211
Comment peroxidase [Nitrospira defluvii]; AA=GCF_000196815.1; RF=representative genome; TAX=330214; STAX=330214; NAME=Nitrospira defluvii; AL=Complete Genome; RT=Major
Sequence
MGLRLGDDAPNFTAETTEGTINFHEWLGGGWGILFSHPKDYTPVCTTELGYMARIKGEFD
KRGVKILAISVDPLDSHRGWTKDINETQNCTVSYPIIADPEKKVADLYDMIHPNSLDSMT
VRSVFVIGPDKKIKLMLTYPASCGRNFDELLRVVDSLQLTAKYKVATPVNWKDGQDCIIT
PAVNDAEAKTLFPKGFKAIKPYLRLTPQPNK
Download sequence
Identical sequences D8PEE3
WP_013248426.1.3676 gi|302037205|ref|YP_003797527.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]