SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013250830.1.3676 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013250830.1.3676
Domain Number 1 Region: 12-287
Classification Level Classification E-value
Superfamily CorA soluble domain-like 7.19e-77
Family CorA soluble domain-like 0.000000346
Further Details:      
 
Domain Number 2 Region: 289-352
Classification Level Classification E-value
Superfamily Magnesium transport protein CorA, transmembrane region 2.22e-22
Family Magnesium transport protein CorA, transmembrane region 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013250830.1.3676
Sequence length 354
Comment magnesium and cobalt transport protein CorA [Nitrospira defluvii]; AA=GCF_000196815.1; RF=representative genome; TAX=330214; STAX=330214; NAME=Nitrospira defluvii; AL=Complete Genome; RT=Major
Sequence
MTMKLKHKHSRKAGLPPGTLVHIGEKKSETVTISVYEYGEGQFQERTVSKPDEIAMTGEP
TVRWVDVGGIHKMEVLESFGKMFSLHPLLLEDIANTDQRPKLDDYGSYGYVVLKMLYEGD
REGDINVEQVSLVFGENFLLSFQENGGDVFQGVKERLRNGKGRLRHAGADYLLYALMDSI
VDRYFVILETLGERIEALQDLCVRSPGPETLRDIHGLKRQLLFLRRSVWPLRDVMNNLSR
SDGQFLQGSTKVFFRDVYDHIIQIGDTIETLREMVSSMMEVYLSSVSYRLNGVMKVLTII
TTIFMPLSFIASIYGMNFEHMPELKSPWGYPAVLGVMAATGLAMLYFFKQKKWL
Download sequence
Identical sequences D8P928
WP_013250830.1.3676 gi|302039613|ref|YP_003799935.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]