SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013250899.1.33448 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013250899.1.33448
Domain Number 1 Region: 7-149
Classification Level Classification E-value
Superfamily Phoshotransferase/anion transport protein 3.66e-32
Family IIA domain of mannitol-specific and ntr phosphotransferase EII 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013250899.1.33448
Sequence length 152
Comment PTS transporter subunit IIA-like nitrogen-regulatory protein PtsN [Olsenella uli]; AA=GCF_000143845.1; RF=representative genome; TAX=633147; STAX=133926; NAME=Olsenella uli DSM 7084; strain=DSM 7084; AL=Complete Genome; RT=Major
Sequence
MAMKLFTEDVFLNVDVKSDSDVLSFMARHLLKEGKVKKGYEEHLLAREFDYPTGLYLGEI
NVAIPHTDYQYANTTQVAIATLSNPVLWRSMEDPDETLSVSVVVLSIFDHPEHQLKVLQQ
IMGVLQNQECVAEITKATTPQQVISAFEKKER
Download sequence
Identical sequences E1QXN3 X8HR14
WP_013250899.1.19134 WP_013250899.1.33448 WP_013250899.1.52174 gi|302334820|ref|YP_003800027.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]