SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013250992.1.33448 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013250992.1.33448
Domain Number 1 Region: 3-94
Classification Level Classification E-value
Superfamily PTS system IIB component-like 0.000000000000445
Family PTS system, Lactose/Cellobiose specific IIB subunit 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013250992.1.33448
Sequence length 98
Comment PTS galactitol transporter subunit IIB [Olsenella uli]; AA=GCF_000143845.1; RF=representative genome; TAX=633147; STAX=133926; NAME=Olsenella uli DSM 7084; strain=DSM 7084; AL=Complete Genome; RT=Major
Sequence
MAKMKHILLSCGSGIVTSTVARKKVEALLDSHGYKGQYEITQIPLASAPEKSRNYDFIVA
TSIAPTELHCPYVNGVPYLMGRGAEETDAQILKLMEED
Download sequence
Identical sequences E1QXX6
WP_013250992.1.19134 WP_013250992.1.33448 gi|302334913|ref|YP_003800120.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]