SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013251215.1.19134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013251215.1.19134
Domain Number 1 Region: 13-194
Classification Level Classification E-value
Superfamily Archaeal IMP cyclohydrolase PurO 1.15e-24
Family Archaeal IMP cyclohydrolase PurO 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013251215.1.19134
Sequence length 222
Comment IMP cyclohydrolase [Olsenella uli]; AA=GCF_001437585.1; RF=na; TAX=633147; STAX=133926; NAME=Olsenella uli DSM 7084; strain=DSM 7084; AL=Scaffold; RT=Major
Sequence
MQDLLELLRTNPYPGRGIVVGTDRSGRPAVYYWIMGRSSNSRNRVFVATEDGIRTEAHDP
SRLEDPSLIIYHPVRAMGDALVVTNGDQTDTIVERGSLHAGCMERSYEPDSPNFTPRISA
IVQADGSFELSLLKRQGGNDPAASDRCVREFFAYEGADARTGYFISTYQGDGNPLPSFSG
EPVEVALPAADKIWGALDADNKVSLYANVGGKVRLYNKNLGD
Download sequence
Identical sequences E1QYJ9
gi|302335136|ref|YP_003800343.1| WP_013251215.1.19134 WP_013251215.1.33448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]