SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013251398.1.33448 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013251398.1.33448
Domain Number 1 Region: 1-145
Classification Level Classification E-value
Superfamily DTD-like 6.67e-53
Family DTD-like 0.00000966
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013251398.1.33448
Sequence length 154
Comment D-tyrosyl-tRNA(Tyr) deacylase [Olsenella uli]; AA=GCF_000143845.1; RF=representative genome; TAX=633147; STAX=133926; NAME=Olsenella uli DSM 7084; strain=DSM 7084; AL=Complete Genome; RT=Major
Sequence
MRALVQRVSEASVAVGGEVVGQCGRGLVVLLGVGPNDDETSCRRLWDKVRDLRVFDDADG
RMNLALGAVGGGVLVVSQFTLYADCRRGLRPSFTGAANPQLGRRLYDRFCALAERDVSHV
GRGVFGADMQVSLVNDGPVTIWLDTDELSRRGVG
Download sequence
Identical sequences E1QZ32
WP_013251398.1.19134 WP_013251398.1.33448 gi|302335319|ref|YP_003800526.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]