SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013274018.1.20439 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013274018.1.20439
Domain Number 1 Region: 160-344
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 5.75e-65
Family Methylesterase CheB, C-terminal domain 0.00000186
Further Details:      
 
Domain Number 2 Region: 4-105
Classification Level Classification E-value
Superfamily CheY-like 9.53e-23
Family CheY-related 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013274018.1.20439
Sequence length 347
Comment chemotaxis response regulator protein-glutamate methylesterase [[Clostridium] saccharolyticum]; AA=GCF_000144625.1; RF=representative genome; TAX=610130; STAX=84030; NAME=[Clostridium] saccharolyticum WM1; strain=WM1; AL=Complete Genome; RT=Major
Sequence
MNEKIRVFVVDDSLLFRKVLIDNLSQNPNIEVVGYAIDAFDAERKIPVIKPDVVTVDVEM
PRLNGIDFVKKLLPNYPVPVILVSSLNLNVFEALSAGAVDFVRKPDMSASNTASTFINTL
ISKIFIASRARIRVPGVPSPIVSQKPVGTGRPFSLNAGNTVIAIGASTGGTEATLQVLKN
LPPDTPGIVVTQHMPEGFTKMYADRLNHLCQMNVKEAQTGDVVERGQVLIAPGDLQMKVI
RSGSRYTVSCFSGEKVSGHRPSVDVLFQSVADAAGASSVGIIMTGMGRDGADGLLKMKKK
GAFTIGQDAESCVVYGMPMVAYNIGAVTVQTACSNISNVLLKHLYTL
Download sequence
Identical sequences D9R9Y0
WP_013274018.1.20439 gi|302387753|ref|YP_003823575.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]