SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013292622.1.12990 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013292622.1.12990
Domain Number 1 Region: 329-486
Classification Level Classification E-value
Superfamily Nucleotide cyclase 2.28e-47
Family GGDEF domain 0.00017
Further Details:      
 
Domain Number 2 Region: 9-136
Classification Level Classification E-value
Superfamily Hemerythrin-like 1.83e-23
Family Hemerythrin-like 0.0036
Further Details:      
 
Domain Number 3 Region: 209-308
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 6.63e-18
Family Flavin-binding PAS domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013292622.1.12990
Sequence length 491
Comment diguanylate cyclase [Gallionella capsiferriformans]; AA=GCF_000145255.1; RF=representative genome; TAX=395494; STAX=370405; NAME=Gallionella capsiferriformans ES-2; strain=ES-2; AL=Complete Genome; RT=Major
Sequence
MNLMNESIEVFPWNDNFSTGIPLIDEQHKRLIHLINLLACGLAYQSDTAELDRIFSELAD
YAVYHFKTEEAVWHAHLADDEWEVEHQHSHNRFVTDLLELKSKKENATVNETLKDILSFL
THWLAFHILESDKHMSKVALGLQAGMTLTDAKLQASADMSGSMKVLIETVLSMYDTLSSR
TLELIKEVIDRQKAEAKLRLAANAIENTLEAICITDHCANIIDANPAFQQITQQPLDALI
GKNLRLLKSGLDDDLVFANIMEKLAEEGHWSGEIKSRSNSGETYTDWLTLSTIKEENGAI
CNYVGIFSNFSRLSGQWQELQHMANHDALTGLPNRLLLADRMELAMAHAERTGSFLAVCY
LDLDNFKPVNDTLGHTAGDLVLREISKRLQSHLRLNDTVSRVGGDEFVILLNDLHKPDDF
EELLVRILQEICLPIGIREQNVFVTGSIGVTQFPHDKGEAAMLLAHADSAMYQAKNLGKS
RYQLYDITKEN
Download sequence
Identical sequences D9SCZ1
gi|302877880|ref|YP_003846444.1| WP_013292622.1.12990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]