SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013293306.1.12990 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013293306.1.12990
Domain Number 1 Region: 77-208
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.00000000000000227
Family UbiE/COQ5-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013293306.1.12990
Sequence length 256
Comment methyltransferase type 11 [Gallionella capsiferriformans]; AA=GCF_000145255.1; RF=representative genome; TAX=395494; STAX=370405; NAME=Gallionella capsiferriformans ES-2; strain=ES-2; AL=Complete Genome; RT=Major
Sequence
MTDCKSTARSLSEWFATTPGGYVLDYEQAWFDRSVNDIFGYNALQLGLSGHDFLRNSRIP
LRFSGEDKTGAALRLCADELPIACGSLDLVLLPHLLEFSALPHAILREVERVLRAEGSLI
ISGFNPHSLWGLHRTMVRRQGYPWCGHFIALHRLRDWLSLLGFEVAEISFDAYAPPFQQW
LSRTDLIESAGKRWWPASGGVYFVHAIKRVPGMRLLKPSWNAGLVKKLLPVAPKLNNPQR
GDTASCDNNVNRLDHE
Download sequence
Identical sequences D9SFS0
WP_013293306.1.12990 gi|302878567|ref|YP_003847131.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]