SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013295387.1.93414 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013295387.1.93414
Domain Number 1 Region: 2-245
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 8.9e-34
Family Phosphate binding protein-like 0.0018
Further Details:      
 
Weak hits

Sequence:  WP_013295387.1.93414
Domain Number - Region: 254-325
Classification Level Classification E-value
Superfamily GlnB-like 0.00111
Family ATP phosphoribosyltransferase (ATP-PRTase, HisG), regulatory C-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013295387.1.93414
Sequence length 328
Comment MULTISPECIES: ATP phosphoribosyltransferase [Methanothermobacter]; AA=GCF_000145295.1; RF=representative genome; TAX=79929; STAX=145263; NAME=Methanothermobacter marburgensis str. Marburg; strain=Marburg; AL=Complete Genome; RT=Major
Sequence
MKIVLGLPKGSLNNVNRGNTYRLFKDAGYEVKGYEPGREENEIEITNDPEIKAYLTRPQS
APVELNREMLDIAIIGEDWVREESINSGDESIKKIGDLDYGQTRLIVALPREEPYTSLED
FFLKNADRNTPILCFTEYPNLTRDFFMNNPGYRELFGDSRPVVQIRGLRDGDNEMVQIIN
SDGATEVYIAKGADLIVDNTQTGSSLRKAGLKIIDTIMESSAGLYAGPSCTGEKLEKAEM
IFKQLYGATKARNYFDVKFNIANHRAEDVVEFLMKMEYCSDEPTVVPGGEFSQINVLIDK
RRFPEMLEEIKGFGASAIVRENVKQYIR
Download sequence
Identical sequences D9PVB5 T2GIB5
gi|304314329|ref|YP_003849476.1| WP_013295387.1.101079 WP_013295387.1.93414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]