SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013297596.1.46247 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013297596.1.46247
Domain Number 1 Region: 4-209
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.09e-58
Family G proteins 0.00014
Further Details:      
 
Domain Number 2 Region: 155-300
Classification Level Classification E-value
Superfamily Translation proteins 4.86e-30
Family Elongation factors 0.0086
Further Details:      
 
Domain Number 3 Region: 401-515
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 3.31e-28
Family EF-G/eEF-2 domains III and V 0.0056
Further Details:      
 
Domain Number 4 Region: 306-390
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 9.35e-16
Family EF-G/eEF-2 domains III and V 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013297596.1.46247
Sequence length 607
Comment translational GTPase TypA [Thermoanaerobacterium thermosaccharolyticum]; AA=GCF_000328545.1; RF=na; TAX=698948; STAX=1517; NAME=Thermoanaerobacterium thermosaccharolyticum M0795; strain=M0795; AL=Complete Genome; RT=Major
Sequence
MGFVRDDIRNVAIIAHVDHGKTTLVDGMLKQSGIFRQNEKVEERVMDSNELERERGITIL
SKNTAIRYNGVKINIVDTPGHADFGGEVERVLKMVDGVLLLVDAFEGPMPQTRFVLSKAL
ELNLKPIVVVNKIDRPDARPEEVIDEVLDLFIELGADDDQIDFPVVYASAREGVAKLNLK
DESVDLRPLFDTILKEIPAPEGNIDDPLQLIVTTLDYDDYIGRIAIGKVVRGKIVSGENV
AICKRDGSVQNVKLSNLYQYEGLKRVQVEDALLGDIVAVSGISDIEIGETIADPEKPEPV
DFVEIEEPTISMTFGVNTSPFAGREGKYVTSRHLRERLFRELETNVALRVEETETTEAFK
VSGRGELHLSILIETMRREGYELQVSKPTVIIKEINGVKHEPIELVTIDIPEDFMGVVME
KMGSRKGELMDMHTLKPGTLRLKFKIPTRGLIGYRSEFLTDTKGNGIMTSVIYDYEPYKG
DIPTRSRGSLVAFEAGTTTTYGLYNAQERGTLFVGPGVEVYEGMIVGENSRSEDIDVNVC
KKKHVTNLRSATADEALRLSPIREMSLEEALEFIANDELVEVTPKSIRLRKKILSAQQRY
KNAKYKQ
Download sequence
Identical sequences A0A223HVA4 D9TNM2 L0IL64
WP_013297596.1.46247 WP_013297596.1.54986 WP_013297596.1.88619 gi|304316567|ref|YP_003851712.1| gi|433654701|ref|YP_007298409.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]