SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013302277.1.89735 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013302277.1.89735
Domain Number 1 Region: 8-148
Classification Level Classification E-value
Superfamily Phoshotransferase/anion transport protein 3.66e-33
Family IIA domain of mannitol-specific and ntr phosphotransferase EII 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013302277.1.89735
Sequence length 156
Comment PTS sugar transporter subunit IIAB [Mycoplasma hyorhinis]; AA=GCF_000313635.1; RF=representative genome; TAX=1118964; STAX=2100; NAME=Mycoplasma hyorhinis SK76; strain=SK76; AL=Complete Genome; RT=Major
Sequence
MDLLKTLKKFNSIQLNLEAKNWQEAIWLSVQPLIEKNAITQDYYNAIIESTIKNGPYYII
ANDLAMPHAQSERGVKENAFSLITLKKPVFFDNDDRPVRILIALAATSPEIHTSVALPQI
VATFEDESVVKQILQAKEAQQVIDIILNIDFKKYLS
Download sequence
Identical sequences E0TKH1 K7XLP3
gi|378835930|ref|YP_005205206.1| gi|385858798|ref|YP_005905309.1| WP_013302277.1.33442 WP_013302277.1.37317 WP_013302277.1.46618 WP_013302277.1.49344 WP_013302277.1.74169 WP_013302277.1.85631 WP_013302277.1.89735 gi|423263053|ref|YP_007013078.1| gi|304373243|ref|YP_003856452.1| gi|558672059|ref|YP_008808768.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]