SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013304638.1.69417 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013304638.1.69417
Domain Number 1 Region: 123-272
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.7e-40
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00044
Further Details:      
 
Domain Number 2 Region: 397-554
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.31e-25
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0015
Further Details:      
 
Domain Number 3 Region: 19-122
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 9.89e-24
Family Duplicated SiR/NiR-like domains 1 and 3 0.016
Further Details:      
 
Domain Number 4 Region: 254-277,305-407
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.74e-21
Family Duplicated SiR/NiR-like domains 1 and 3 0.0054
Further Details:      
 
Weak hits

Sequence:  WP_013304638.1.69417
Domain Number - Region: 656-689
Classification Level Classification E-value
Superfamily AF1782-like 0.00549
Family AF1782-like 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013304638.1.69417
Sequence length 696
Comment nitrite reductase [Maribacter sp. HTCC2170]; AA=GCF_000153165.2; RF=na; TAX=313603; STAX=313603; NAME=Maribacter sp. HTCC2170; strain=HTCC2170; AL=Complete Genome; RT=Major
Sequence
MKSFRTEIENPIVEKDIIELEAKIRQFKEGNLDEEKFRSLRLARGVYGQRQFGVQMIRIK
LPYGKVTSKQLKRICDVSDEYSTGRLHITTRQDIQIHYVDLDRTPELWAQLEKDEVTLRE
ACGNTVRNVTASETAGVDMDEPFDVSPYAQAVFEYFLRNPVGQEMGRKFKVSFSASDADT
GLSYMHDIGFIAKIQNGVRGFKVMLAGGLGSQPRHADVLYDFLEADKIIPKMEAVVRVFD
RYGERKSRAKARLKFLLKDLGLDGFKKLIDEEQVAVPFKQYIIDFESYPKVNIVNVAIPK
VDIIDQKTFEQWKSTNVIPQKQDGYVAIGIKVLLGDFYTDKARLLADLVKNYAAGEIRLS
LRQNILVPYVKEELIPFFYAELEKLGFANPGYNKALDITACPGTDTCNLGIASSTGIAQE
LERVIKAEFPHYINNPDVVIKISGCMNACGQHSMANIGFQGMSIRTKDKLVAPALQVLLG
GGNLGNGRGLFADKVIKVPSRRGPEALRLVLNDYDANGEGLSYASYYEKKGEPYFYNLLK
PLGALDNLTQEDFIDWGAKEKYQKAIGIGECAGVVIDLIATLLYESEEKVQNASSSYGQG
KWAASIYHSYAAMVNSAKALLTAEKTKTNTHSSIIKDFDKIFVDSKRIELKSEFSELVLQ
IKKNEPTSEFAKSYLEDAKYFLESVDAYRKLDLVNV
Download sequence
Identical sequences A4ATR5
WP_013304638.1.69417 gi|305664582|ref|YP_003860869.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]