SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013333570.1.66923 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013333570.1.66923
Domain Number 1 Region: 2-313
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.64e-56
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013333570.1.66923
Sequence length 316
Comment thioredoxin-disulfide reductase [Halomonas elongata]; AA=GCF_001678785.1; RF=representative genome; TAX=2746; STAX=2746; NAME=Halomonas elongata; strain=HEK1; AL=Contig; RT=Major
Sequence
MSEARHERLIILGSGPAGYTAAVYAARANLKPLLITGIQAGGQLTTTTDVDNWPGDDIGV
QGPELMERMKRHAERFETEVLFDHVHEVELRERPFTLKGDNGTYTCDALIIATGASARYL
GLESESRFMGQGVSACATCDGFFYRNQDVVVVGGGNTAVEEALYLSNIASKVTLVHRRDS
LRAEKILQDKLFDKVENGNIEVIWNHTLDEVLGDNTGVTGARLKSTEDGSTRELDAPGVF
IAIGHSPNTGIFEGQLDMAGGYIKVQSGLEGNATATSVPGVFAAGDVMDHVYRQAVTSAG
SGCMAALDAERYLDEL
Download sequence
Identical sequences A0A1B8NX36 E1V926
WP_013333570.1.66923 gi|307546404|ref|YP_003898883.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]