SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013336388.1.43420 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013336388.1.43420
Domain Number 1 Region: 4-246
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 9.69e-64
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.00084
Further Details:      
 
Domain Number 2 Region: 235-375
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 5.48e-16
Family Medium chain acyl-CoA dehydrogenase-like, C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013336388.1.43420
Sequence length 377
Comment acyl-CoA dehydrogenase [Vulcanisaeta distributa]; AA=GCF_000148385.1; RF=na; TAX=572478; STAX=164451; NAME=Vulcanisaeta distributa DSM 14429; strain=DSM 14429; AL=Complete Genome; RT=Major
Sequence
MSESELERFRDYVKDWFIKNAPPEMRIRRGGIGWYYEDPRFIDAAVRWHRTLYNAGLVGI
SWPKEYGGYGDDVRKELVVRDVALSLGIVYPGCPGIGLSVAGPAILFHGSEEQKRRYLRR
ILTCEDVWAQGFSEPCCGSDLAAITTKAEDRGDYFVLNGRKVWSSDFHLANYYLVLARTG
SPEERHKGLTMFIVDTRSEGITYRPIKQINGRPGFSEVFLDNVKVPKDNVVGKVGDGWRV
AMTTLNFERLNIGGAFAYAAASAARHLVEVRRDADTLALLEEALAVKELYDRMLMLALRG
EMVGPEAASIKLLASEVLEKIYIAAVSKLGPEALAEGDLFEWSFGYIDSKGYTILSGTSE
ILRNLLGELVLGLPKGV
Download sequence
Identical sequences E1QRU6
gi|307595397|ref|YP_003901714.1| WP_013336388.1.43420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]