SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013336636.1.43420 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013336636.1.43420
Domain Number 1 Region: 213-463
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.9e-71
Family Leukotriene A4 hydrolase catalytic domain 0.00038
Further Details:      
 
Domain Number 2 Region: 16-205
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 2.35e-36
Family Leukotriene A4 hydrolase N-terminal domain 0.0022
Further Details:      
 
Domain Number 3 Region: 546-737
Classification Level Classification E-value
Superfamily ARM repeat 6.33e-28
Family PBS lyase HEAT-like repeat 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013336636.1.43420
Sequence length 840
Comment aminopeptidase [Vulcanisaeta distributa]; AA=GCF_000148385.1; RF=na; TAX=572478; STAX=164451; NAME=Vulcanisaeta distributa DSM 14429; strain=DSM 14429; AL=Complete Genome; RT=Major
Sequence
MSFDKAGYLIGRNFVYPDYRPQFPKHYGYALKHLRAQIRVKTSERAIEGLAEYSIDVPPG
RDYIELDAAEMKIISVKVNGQDTKFEYDGRVLRVYISPGNHTVQVNYETKPRKGLYFILP
DEHYRDRVPMVWTQGESEDNHYWIPMPDYPNVKFTSELLIIVPKTWTAVSNGILVETKDL
GDEVLWHWRLDKPHSAYLVAFAAGEFEVVREDCDGITIEHYVPRGFGDRARFSFYRTCDM
IRFYSEYTGVRYPWPNYKHVAVSEFIYGGMENTTITIVTDTTLHDEHAHCPGSRFPCPGM
EDFTSDGLVAHELAHQWFGDYVTTKDWANIWLNEAFATYFEALYTERAKGRDEFLYELYQ
NLRSYLNEYGNRYARPIVTRMYKDPEEMFDRHTYEKGSLVLHTLRNLLGDEVFQKGINLY
LTRHAHGNADTEDLRKALEEVSGQPLDWFFTQFVYSSGHPVIKYSWSYDPGNKFIKLSIS
QAQGDDSYPIYRLPLEFEIKYPSGKVDLLRIELNEREVTIYVPASERPQYVCIDPQFKVG
VKSVSSDKGVEEAIAELGSDNIMCRLEAIDALARDGSARAVEGLSKALMNDPFWGVRAEA
ARALGRVGTDDALKALLNALNNERHPRVRQAIAEALGNFKGNGDAARVLTSILENTSESY
YVRSKAAQSLGKLGMMDYAGELIKALNYPSHNHVITQGALQGLSELGTDEAVDTLIKYTE
LGKPTLVRMVATQSLGKFVGIRRVYDRIRELLKDPYYRVRYAAVAAVESSLDPRFLDALD
DLASRDLDGRIRRYARDVARKIREQMQRGVEYARLREEIERIREEQRRIMDRLGRMEAKG
Download sequence
Identical sequences E1QTB8
gi|307595645|ref|YP_003901962.1| WP_013336636.1.43420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]