SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013350682.1.27002 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013350682.1.27002
Domain Number 1 Region: 58-148
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 1.44e-22
Family Ribosomal protein L9 C-domain 0.00059
Further Details:      
 
Domain Number 2 Region: 3-57
Classification Level Classification E-value
Superfamily L9 N-domain-like 5.41e-17
Family Ribosomal protein L9 N-domain 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013350682.1.27002
Sequence length 152
Comment 50S ribosomal protein L9 [Glutamicibacter arilaitensis]; AA=GCF_000197735.1; RF=representative genome; TAX=861360; STAX=256701; NAME=Glutamicibacter arilaitensis Re117; strain=Re117; AL=Complete Genome; RT=Major
Sequence
MAKIILTHEVSGLGAAGDIVEVKNGYARNYLLPRGFAIVWTQGGEKQVESIKAARAARAV
ANLEDAQALAAKLKSQPVKITMKAGSNGRLFGTVKTTEIAAAVEAAGLGKIDKRNIEVND
QIKSTGNYTATVRVHADVVANLRLQVVAAAKK
Download sequence
Identical sequences E1W133
WP_013350682.1.27002 gi|308179151|ref|YP_003918557.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]