SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013361928.1.92012 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013361928.1.92012
Domain Number 1 Region: 165-355
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 7.32e-61
Family Methylesterase CheB, C-terminal domain 0.00000588
Further Details:      
 
Domain Number 2 Region: 1-112
Classification Level Classification E-value
Superfamily CheY-like 3.56e-29
Family CheY-related 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013361928.1.92012
Sequence length 357
Comment chemotaxis response regulator protein-glutamate methylesterase [[Clostridium] sticklandii]; AA=GCF_000196455.1; RF=representative genome; TAX=1511; STAX=1511; NAME=Acetoanaerobium sticklandii; strain=DSM 519; AL=Complete Genome; RT=Major
Sequence
MQSIKVLIVDDSAFIRKMLKDLLEIDASIKVVAAVKNGKEAIEFLESSYVDVITLDVEMP
VMDGIATLKEIMRVRPTPVVMLSSLTKEGAEMTFKALDLGAVNFLAKPTNIFKISSSADI
QDSIIDKVKEASKVRVNKIAAIRPKDNKISYTESSSMNSSIKNSDIKKIVAIGTSTGGPR
ALQEVISNLSGSFPAPVLIVQHMPKGFTKSLADRLDSISRIRVKEAEDNEIVENATVYIA
PGDRHLKIEAFSKNKYRIRLDDGPNVSGHKPSVDALFYSLCDVPTNDIITVIMTGMGADG
AKAMEQLKLIKKSTTIVEDESTCVVFGMPKSAIATGKVDKILPLNKIAAELNKMLGV
Download sequence
Identical sequences E3PSI1
WP_013361928.1.92012 gi|310659019|ref|YP_003936740.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]