SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013370094.1.14980 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013370094.1.14980
Domain Number 1 Region: 210-404
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.07e-73
Family B3/B4 domain of PheRS, PheT 0.00000246
Further Details:      
 
Domain Number 2 Region: 478-708
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.62e-49
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0003
Further Details:      
 
Domain Number 3 Region: 37-197
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.35e-47
Family Myf domain 0.0032
Further Details:      
 
Domain Number 4 Region: 716-814
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 1.31e-32
Family Anticodon-binding domain of PheRS 0.00063
Further Details:      
 
Domain Number 5 Region: 414-486
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 2.66e-17
Family Domains B1 and B5 of PheRS-beta, PheT 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013370094.1.14980
Sequence length 815
Comment phenylalanine--tRNA ligase subunit beta [Paenibacillus polymyxa]; AA=GCF_000164985.3; RF=representative genome; TAX=886882; STAX=1406; NAME=Paenibacillus polymyxa SC2; strain=SC2; AL=Complete Genome; RT=Minor
Sequence
MKVSFDWLSEYVSLDQVSAEELAEKITRSGIEIDEVEHRNQGITGVVVGYVKSKEKHPDA
DKLNVCIVDAGQGEDLQIVCGAKNVDAGQKVPVAVVGAKLPGDFHIKKAKLRGVVSMGMI
CSAKELGMNDKLLPKELQEGILVLPEDAEIGTPITKLLALDDQVLDFDLTPNRSDCLSMH
GAAYEVSAILGRNISLADPAKDLVEINDAAADHLSVKVDTPELCTHYAARYITGVKVGPS
PLWIQNRLMAAGVRPINNIVDITNYVMLEYGQPLHAFDADKLENGNIEVRLARTGETLIT
LDDQERKLEPHMLLITDGVKPIALAGVMGGANSEVTDATVSIALESAKFDGGTVRKTSRQ
LGLRSEASLRFEKEVDPGAVIPAVNRAAALIQRYAGGTVHQGIVESASAKAENHIIKLSL
DKINRYLGTELSLLEVKTIFGRLHFGCGDTEPGVLEVEVPTRRGDITIDVDLIEEVARLY
GYDNIPTTPIEGPTTPGALTASQSLRRSLRRLLAHGGWQETISYSFVHPQSTALFNALTE
GSHPVRLAMPMSEDRSVLRTSIIPQMLDTAVYNMNRKQDNLAIFEMGTVFYTEEQTLTRQ
PQEIQVLSLLLTGVRREKQWNIGAEKVDFFDIKGALETVFDYFGLSASIRYVADQPQSYH
PGRSASVWLDVNGSSQRIGTVGQIHPELQQSYGLNDTYVAEIALQQLVEHANSHIQFREL
ARFPSVERDIALVVNKDVEAGELLRVIHAAGGELLQDARVFDVFTGSKLGEDKKSVAISL
TYRHWEHTLTDEEINAAHSPVVTSLEQTFGAELRK
Download sequence
Identical sequences E3EFH6
WP_013370094.1.14980 WP_013370094.1.91857 gi|310640950|ref|YP_003945708.1| gi|386040044|ref|YP_005958998.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]