SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013393378.1.51351 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013393378.1.51351
Domain Number 1 Region: 157-346
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 2.62e-71
Family Methylesterase CheB, C-terminal domain 0.000000167
Further Details:      
 
Domain Number 2 Region: 1-108
Classification Level Classification E-value
Superfamily CheY-like 4.41e-28
Family CheY-related 0.00000603
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013393378.1.51351
Sequence length 352
Comment MULTISPECIES: chemotaxis response regulator protein-glutamate methylesterase [Achromobacter]; AA=GCF_001299355.1; RF=na; TAX=1806481; STAX=1806481; NAME=Achromobacter sp. 2789STDY5608625; strain=2789STDY5608625; AL=Scaffold; RT=Major
Sequence
MKKISVLCVDDSALVRGLMTEIINSQPDMEVVATAPDPLVARELIKRHNPDVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTERGGEITLRALELGAIDFVTKPKLGIRDGLLEYT
EIIADKIRAASRAKLRAPAAHAAPAAPAPMLRRPLSSSEKLVIVGASTGGTEAIREVLQP
LPPDSPAILITQHMPAGFTRSFAQRLDALCAVTVREAVHGDRVLPGHVYLAPGGDMHMRL
GRSGANYVIELEASEPVNRHRPSVDVLFNSAAVAAGKNAIGVILTGMGKDGAAGMLAMHR
AGAHTIAQDEASCVVFGMPREAIALGAADEVVSLSAISERILTRLGDRGHRV
Download sequence
Identical sequences A0A0M7KIB5 E3HSB4
gi|311105922|ref|YP_003978775.1| WP_013393378.1.51351 WP_013393378.1.79376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]