SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013402932.1.12921 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013402932.1.12921
Domain Number 1 Region: 83-176
Classification Level Classification E-value
Superfamily Ribosomal protein L6 8.06e-35
Family Ribosomal protein L6 0.0000222
Further Details:      
 
Domain Number 2 Region: 1-82
Classification Level Classification E-value
Superfamily Ribosomal protein L6 6.17e-30
Family Ribosomal protein L6 0.0000564
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013402932.1.12921
Sequence length 182
Comment 50S ribosomal protein L6 [Caldicellulosiruptor hydrothermalis]; AA=GCF_000166355.1; RF=na; TAX=632292; STAX=413888; NAME=Caldicellulosiruptor hydrothermalis 108; strain=108; AL=Complete Genome; RT=Major
Sequence
MSRIGRKPIDIPSGVDVKIDGNVITVKGPKGTLTRKIHPEMIVKIENNQIIVQRPSDERF
HKALHGLTRTLIANMVEGVTKGYEKVLEVVGIGYRAQKQGKKLILNVGYSHPVEIEEPAG
ITIEVPDQNRIIVKGIDKQQVGNFAANIRKVREPDPYLGKGIKYADEVLRLKEGKAGKGG
KK
Download sequence
Identical sequences E4Q830
WP_013402932.1.12921 gi|312127241|ref|YP_003992115.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]