SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013409318.1.101163 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013409318.1.101163
Domain Number 1 Region: 272-505
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.16e-31
Family Quinoprotein alcohol dehydrogenase-like 0.0024
Further Details:      
 
Domain Number 2 Region: 179-257
Classification Level Classification E-value
Superfamily PKD domain 5.49e-16
Family PKD domain 0.001
Further Details:      
 
Domain Number 3 Region: 41-100
Classification Level Classification E-value
Superfamily PKD domain 0.00000000000000641
Family PKD domain 0.001
Further Details:      
 
Domain Number 4 Region: 120-176
Classification Level Classification E-value
Superfamily PKD domain 0.0000000000000327
Family PKD domain 0.00098
Further Details:      
 
Domain Number 5 Region: 496-589
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000000000000196
Family Quinoprotein alcohol dehydrogenase-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013409318.1.101163
Sequence length 610
Comment PKD domain-containing protein [Leadbetterella byssophila]; AA=GCF_000166395.1; RF=representative genome; TAX=649349; STAX=316068; NAME=Leadbetterella byssophila DSM 17132; strain=DSM 17132; AL=Complete Genome; RT=Major
Sequence
MRKLLFPLILLLLSACTESDSPSKKEEISAEFTFQFQSKNLVQFTSKETNADSYQWEFGD
GKTSSEANPLHKYDNNGSYKVTLTVKSANQNVSTSQNLEVSDITKPISQFTYEIKSRGVV
EFKSSASFATEHHWDFGDGEKSHAINPTHTFKNNGNYTVSLKVTNEFGEHSSSQNLALTQ
VLPPEANFTFVIDKGKVSFTNRSANADSFIWDFGDGASSLEYHPVHTYKSNGSYIVKLTA
ANTFEQHVIEKTVSVTGLGPSTANQTLYLSTFTNKTILEALDASTGELKWARDGYEGRIE
GAITAVGNTLYFCTNTHLYAVDASNGNVRWRYNAGSSGSPLVQDGRVYFGSNNHHVYAIN
ASNGNVIWSTPVASAISASVILDNQILYVGTHAPSSGGGGIFYALNASNGSIHWQRGTYG
GSMNTKAQISGNYVYFGGSVGIHILNKHQGSGHEGLIAYSFKQIQNSSPIVSDQHIFGVV
DGNVFQRIDVINNADIWSVNLGTSDHKASPVLIGNTFYITARSKVLSINKGNGAENWSFN
GSNFSSRNVTYANDIVYVTDNKGSSSELLALDAKNGQVIFRTNVQGSSGDITVIGKDGKS
WYPGSTGQNP
Download sequence
Identical sequences E4RZN8
WP_013409318.1.101163 gi|312131294|ref|YP_003998634.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]