SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013420669.1.77764 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013420669.1.77764
Domain Number 1 Region: 5-155
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 1.62e-32
Family Deoxycytidylate deaminase-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013420669.1.77764
Sequence length 212
Comment tRNA-specific adenosine deaminase [Rhodomicrobium vannielii]; AA=GCF_000166055.1; RF=representative genome; TAX=648757; STAX=1069; NAME=Rhodomicrobium vannielii ATCC 17100; strain=ATCC 17100; AL=Complete Genome; RT=Major
Sequence
MAWWNAADEAMMLRCIELSREATREGDYPFGALIALDGEIVAEAGNRAMRDADFSRHAEI
IAIAAALKTVGRGGLARATLYSTVEPCAMCSFCIREAWVGRVAYALASPAMGGVSKWTIL
HDADLGRQLPIFGPAPEVVSGLLAGEALAAWREWNPAATELARLRGALTDETAQQDEPRH
LPAHARSMAQRVVLPFLRLAAWREKHAQLSDR
Download sequence
Identical sequences E3I0X9
gi|312115805|ref|YP_004013401.1| WP_013420669.1.77764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]