SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013443405.1.53399 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013443405.1.53399
Domain Number 1 Region: 169-355
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 3.53e-69
Family Methylesterase CheB, C-terminal domain 0.000000668
Further Details:      
 
Domain Number 2 Region: 1-108
Classification Level Classification E-value
Superfamily CheY-like 4.7e-28
Family CheY-related 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013443405.1.53399
Sequence length 360
Comment MULTISPECIES: chemotaxis response regulator protein-glutamate methylesterase [Methylovorus]; AA=GCF_000183115.1; RF=na; TAX=887061; STAX=887061; NAME=Methylovorus sp. MP688; strain=MP688; AL=Complete Genome; RT=Major
Sequence
MNKIKVMIVDDSAVVRQVLTSYLEASKEVEIIGAASDPIFAIEKMQKEWPDVIILDVEMP
RMDGITFLKKIMAQRPTPVIICSTLTEKGAETTMEALAAGAVSIITKPKAGLKSFMTESA
DDLVQHIKAAAKANVRKILHHDPQPVLKTPAKLTADAVLAPKPAAMAQTTEKIVAIGTST
GGTQALERVLTALPRVCPGIVIVQHMPENFTAAFAARLNQLCAIEVKEAAKGDRVVMGRA
LIAPGGKHMVLKRSGAQYFVDVIDGPPVSRHKPSVNVLFRSVAQSAGKNALGIIMTGMGD
DGAQGMKEMHEVGATTVAQDERSCVVYGMPKEAVKLGGVNKSISLDAIAAEIQNYGAMHR
Download sequence
Identical sequences C6XBG9
gi|313202361|ref|YP_004041019.1| gi|254000403|ref|YP_003052466.1| 582744.Msip34_2702 WP_013443405.1.53399 WP_013443405.1.76919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]