SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013444567.1.41328 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013444567.1.41328
Domain Number 1 Region: 296-521
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.91e-34
Family ABC transporter ATPase domain-like 0.0003
Further Details:      
 
Domain Number 2 Region: 67-289
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 3.79e-18
Family DNA repair protein MutS, domain III 0.012
Further Details:      
 
Domain Number 3 Region: 742-816
Classification Level Classification E-value
Superfamily SMR domain-like 0.0000000667
Family Smr domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013444567.1.41328
Sequence length 818
Comment endonuclease MutS2 [Paludibacter propionicigenes]; AA=GCF_000183135.1; RF=representative genome; TAX=694427; STAX=185300; NAME=Paludibacter propionicigenes WB4; strain=WB4; AL=Complete Genome; RT=Major
Sequence
MLYPDHFEQKIAFTTIRQLLKDKCVSTLGEEKVDEIQFSSDYADVMRLLSQTDEMLRVLT
TNADELPIGDFYDVRPALSRIRVEGLFLDELEVFDLRRALEAVRLLVAFLTKHEAEVYPH
LHELVSEVETFPLIVNRIDAILNKFGKIKDNASPELARIRKDIFQVQSGISRTLNSILRQ
AQADGYVEKDVAPTMREGRLVIPVSPAFKRKVNGIVHDESATGKTVFIEPQQVVEANNRV
RELEGEERREVMRILVDFTNFVRPYTESIFSSQYFLGQIDFLRAKALFGLDIKAIKPRVD
DCCQLEWAKAIHPLLFLSLKKQGKEIVPLDITLNEKQRILLISGPNAGGKSVCLKTVVLL
QYMLQCGLLVPLHDSSRAGIYERLFIDIGDEQSIENDLSTYSSHLLNMKFFIKNSNPKTL
LLIDEFGTGTEPMIGGAIAEATLERFNQNLAFGVITTHYTNLKHYAEDAEGIVNGAMLYD
RQHLQPLFQLSIGNPGSSFAVEIARKIGLPEDLIAEAAEKVGAEHLDYDKHLQDIVRDKR
YWENKRQQIRQKEKRLEETLAKYEEEMAGIDKQRKEITNKAKDEAKNLLNEANAKIENTI
RQIKEAEAEKVRTQAVRKELDDFKKKIGNEPETGRDRSRPVQIPKPIHKDRSRPVPTSNA
EHETLKIGSNVRMKGQTATGTIIEMQDKQALVAFGNLKSTVKLNQLEAISNNQLKKEARK
YESLGSTATDEVRQRKLTFQSEIDVRGMRGDEALQAVMYFIDDAVMVGVASVRILHGTGT
GALRQMIRQYLGTTHGIRTYRDEHIQFGGAGVTVVEFE
Download sequence
Identical sequences E4T3A4
gi|313203526|ref|YP_004042183.1| WP_013444567.1.41328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]